DPCstruct | MC1928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 80 ± 4 aa |
| Standard deviation of domain lengths | 3.98 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 56.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287HTM0 | 123-201 | NPVELLQRYRRDRHVLLNYILSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKKGDPLDLGDAIRLYHDSLDYPYV |
| A0A484NL76 | 2-80 | DGASLLQRYRRDRRKLLEFLLSSGLIKEIRTPAGSSTVSNLNLDALSIDYVLECIQSSRVVDVSVASKRYREELQQPIT |
| A0A6J1J4S2 | 1-83 | None |
| U5DD15 | 2-80 | None |
| A0A1U7USZ1 | 1-86 | None |
| A0A2I0ASH9 | 9-83 | None |
| A0A7J7LCM6 | 3-88 | None |
| A0A2G9H8E8 | 7-81 | None |
| A0A843XMF3 | 1-79 | None |
| A0A834YDX0 | 6-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.