DPCstruct | MC19279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Standard deviation of domain lengths | 4.64 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 93.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1K628 | 3-89 | SLATNAPTSADACLSIVHSLMCHRQGGESEGFAKRAIESLVKKLKEKRDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGF |
| B0W698 | 206-284 | MPTAAPTSADACLSIVHSLMCHRQGGESEGFSKRAIESLVKKLKEKRDELDSLITAITTNGAHPSKCVTIQRTLDGRLQ |
| A0A553PH47 | 32-118 | None |
| A0A6P8Z4L8 | 56-134 | None |
| A0A091QM91 | 5-83 | None |
| A0A182H6G8 | 268-354 | None |
| A0A452RHI2 | 9-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.