DPCstruct | MC19278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 370 ± 86 aa |
| Standard deviation of domain lengths | 86.28 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 79.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.17 |
| Pfam Score | 83.50 |
| Assigned Pfam label(s) | CL0236- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150FXX6 | 423-702 | VSVEVDVVAQEGHCWIEVKNQEPFGLESVHWAGHAPGASRRVKGLRRQVAELLAVASHPTHARRWRAPAVVVFFPGPDPGCAHPDVV… |
| A0A7R9G8B2 | 735-1064 | SSNLDHFGGLVDSVEALLAVGRRCQSVMKKFRREEPNSCLDVDVVADEGSTWIKVVARNPMGTFSVFRDASETGYRTIVGVGELWLE… |
| A0A4U5M8G3 | 226-558 | None |
| A0A0F7SNB8 | 5-477 | None |
| A0A7S1SLW1 | 2-267 | None |
| A0A0D6MCJ8 | 578-956 | None |
| A0A139AYM0 | 3-445 | None |
| A0A4D8ZVC7 | 1-346 | None |
| A0A364MW71 | 30-508 | None |
| A0A139WM07 | 160-516 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.