DPCstruct | MC19276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 9.49 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 56.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9BYV5 | 13-92 | SETSVKICLAPLSTDPVAIQKRQECCNSNEFITVDAAKSGHVKREIRVMADGVYDLLHMGHILMLKQAKEAFPNVYLIAG |
| A0A6P7UDM3 | 11-83 | PAPFSDEPQAIAECERCDYSTKITKEMASSGLAPRPVRVYADGIYDLFHQGHARQLMQAKSAFPNVYLIVGVN |
| A0A498M2N7 | 10-86 | None |
| A0A813M444 | 70-143 | None |
| A0A194R7H3 | 22-116 | None |
| A0A2H2J3F3 | 10-78 | None |
| A0A7R8CGH9 | 438-509 | None |
| A0A7I8VNL3 | 22-96 | None |
| A0A6L5DHY6 | 138-203 | None |
| A0A177BEJ3 | 538-623 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.