DPCstruct | MC19271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 253 ± 58 aa |
| Standard deviation of domain lengths | 58.09 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 65.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.25 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A194QT60 | 1-209 | MASTMQLEFTQAMTDFKTMFPDMDDDVIEAVLRSNQGAVDATIDQLLAMSTDNQNERLRLEMERVEGGSPRRKTLLTSATKGNVVVN… |
| A0A7R9BHC0 | 7-223 | PEPTVELEFLQAMRDFKTMFPDMDSDVIEAVLRANDGSVDASIDELLTMSSVDGMNKLVTKKTERQPPQDAVDREGYWVGGGDPNGI… |
| A0A4C1TC92 | 1-244 | None |
| A0A080ZE55 | 3-167 | None |
| A0A7M5UQ02 | 46-265 | None |
| A0A402FUF0 | 20-300 | None |
| A0A6H5HMR6 | 1-164 | None |
| H3CHC3 | 19-383 | None |
| K3WYW1 | 2-222 | None |
| A0A7E4RYW2 | 1-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.