DPCstruct | MC19269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 135 ± 15 aa |
| Standard deviation of domain lengths | 15.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A494U9A9 | 209-333 | EYVVLTIEETGNAAFVDLGRDQEVARIIDEAADKIASHSSIGDADFALRDVNGNRVGRVEITTVTPTGDVPDGTVRLAIETGNAAFE… |
| A0A402GKK6 | 1-125 | MKNNIEITMTTGNAAFEGDKTIEFARIIKKLAQSIEHGSVPARLLDLNGNKVGEVVVDGEKEIERFDSDSIYIEISTSNAAFEEAGT… |
| A0A1W1Z4Q5 | 451-598 | None |
| A0A7Z7J0F4 | 373-491 | None |
| A0A5N7WD96 | 160-327 | None |
| A0A5N7W7G1 | 624-748 | None |
| A0A0Q0EWQ0 | 261-409 | None |
| A0A193GNB9 | 487-616 | None |
| A0A0Q0EWQ8 | 360-487 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.