DPCstruct | MC19263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 627 |
|---|---|
| Mean domain length (aa) | 182 ± 45 aa |
| Standard deviation of domain lengths | 44.65 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 82.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 14.30 |
| Pfam Score | 97.10 |
| Assigned Pfam label(s) | CL0163- CL0236- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846D3U9 | 2-135 | LITTIKYGLEVHFKDDPNVFVAGDLLWYPIQGQPKINQAPDVMVVIGRPKGHRRSYKTWVEDNLNPQVTFEIASLTNTIKELEDDKL… |
| A0A2B7XXA6 | 4-193 | LSDMDLRQESRKRRINYHRSPHILIVKIPCVLTEVAISSFGMLATLFLCEMGLFWDLLATGAAHVEGSERTKCPYCSYRPFQLPRGR… |
| A0A3N4IRY9 | 27-259 | None |
| Q2MG43 | 7-145 | None |
| A0A1L9WJK0 | 3-156 | None |
| A0A1L9TI10 | 55-183 | None |
| A0A7S2RDA1 | 10-146 | None |
| F4PLW0 | 43-216 | None |
| A0A518I1K5 | 62-240 | None |
| A0A3N4IX30 | 1-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.