DPCstruct | MC1926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 53 ± 5 aa |
| Standard deviation of domain lengths | 4.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 54.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482VNI9 | 1-58 | MNRLNTNNVIEPIVKDFDYQMQIPFLLYRNSKSKIFGIWFFNREECVHITYLIETVME |
| A0A0V0GT65 | 4-55 | RSAENMVEDLLGDFEFEVQVPYLLYRNAAQEVNGIWFYNAHEIEEVADLFGR |
| A0A078GCA9 | 376-424 | None |
| A0A1A8IWY3 | 1-58 | None |
| A0A453HNJ0 | 1-49 | None |
| A0A4Y7LHH1 | 469-517 | None |
| Q0IUI3 | 10-59 | None |
| A0A4V6D0A9 | 1-58 | None |
| A0A287SWK7 | 131-184 | None |
| A0A0A9R757 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.