DPCstruct | MC19257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 120 ± 19 aa |
| Standard deviation of domain lengths | 19.22 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4GEC6 | 131-225 | EMLQVVNAFRPFTDTVDGCVRIQEEIEAASGLATTGIISNAHLMDDTDVDVIVRGAELAVRVAERRGLAFRFLTAMRPLAAAAAART… |
| A0A645BK08 | 12-92 | MLFVANFFRPLTKTAEDALQVLREVEAACGMRATALVNNSNLGAETTAQDVLGTLDRMEHFARLSGLPIAFTSVSERLKEK |
| A0A829I1U5 | 33-164 | None |
| A0A350BGH9 | 183-308 | None |
| A0A7V1N7F9 | 109-258 | None |
| R6WEX0 | 1-93 | None |
| A0A847C6S5 | 2-119 | None |
| R6HYL5 | 7-137 | None |
| A0A3D0YZ76 | 73-200 | None |
| A0A7C4F873 | 92-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.