DPCstruct | MC19255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 389 ± 41 aa |
| Standard deviation of domain lengths | 41.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7WU92 | 85-451 | LQHSFWYLPSVAACHAMANLLAEKHNVFWHDYDVVVAAGASAGIGLDALPPVREAIGGGFDTKTITLSCGKLTTGVTVPQWSSILML… |
| A0A645BBT1 | 1-327 | MVAAGSEAGQGAEAMIPVERAMENPLKTQTITLTCGKLTTGVTVKPWTGIFMLRNLKQPESYFQAAFRVQSPWTAGKEIIKEECYVF… |
| A0A7J5L7T7 | 8-383 | None |
| A0A2X0QE30 | 344-749 | None |
| A0A7H1MRM3 | 394-813 | None |
| D4XVK0 | 58-430 | None |
| A0A4S2F2L3 | 385-836 | None |
| A0A1M4WE03 | 478-848 | None |
| A0A6I1AZ79 | 1-338 | None |
| A0A350MQZ7 | 249-667 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.