DPCstruct | MC19251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 244 ± 24 aa |
| Standard deviation of domain lengths | 23.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U4VAA7 | 8-213 | MGFRGIIAPYNNGYGIQTTLTRRNQQAVAMNTYHDPNDNMTGPIFQTSSFDGAVAYVRNAAATRLAAKPFVMTEYDHVFWNRHRYEA… |
| A0A1G2Z8X3 | 9-256 | FIDFLWETERDYWWGMDRYLKDELGLRSLVAGTQLSYSPPHVQAGLDYVDAHSYWKHPHFPGRPWDPNNWQVHNVALVNSPGGTLAG… |
| A0A497QD48 | 323-540 | None |
| A0A3C0ELE3 | 73-326 | None |
| A0A7V2YYR7 | 815-1087 | None |
| A0A2E0XGN1 | 18-225 | None |
| A0A7C3S7V8 | 269-496 | None |
| A0A2V2BW93 | 644-936 | None |
| A0A1I0YXV4 | 269-513 | None |
| A0A7X9J529 | 311-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.