DPCstruct | MC1925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 84 ± 6 aa |
| Standard deviation of domain lengths | 6.37 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0GLH2 | 5-90 | VVDTQVQIEKHIQAALVGRDYSVESLLAKRHQIRGLIFSPMGEALSERTYALHLKEILQLGTVQSLPFRRVERAIKDFNLFLELER |
| A0A0D2LZH0 | 63-131 | EAALVHSGFSPENIIRNRHLIRGFVFYDHGRALSLRTYRAYLNEIARLGTRDTRPYQRILNAIRNFDIF |
| A0A2K3NWS4 | 173-249 | None |
| A0A251SNC7 | 91-178 | None |
| V9P5A6 | 76-168 | None |
| A0A6V7PYX5 | 92-159 | None |
| A0A068VCK6 | 119-204 | None |
| A0A2Z6LN57 | 144-225 | None |
| A0A7J0HE90 | 333-418 | None |
| A0A445EXK1 | 333-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.