DPCstruct | MC19249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 352 ± 28 aa |
| Standard deviation of domain lengths | 28.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5YYY1 | 127-433 | GQHFLQDFLLLALKIKSTDELTVFTRAMLGCVSELQTSLGAVTELSPAWIMAAAKHFALRLDTLCHIFLLQPQLAHNVQKQGGKREP… |
| A0A822GYI2 | 1-349 | MTNDGNELLSLPWVHIGYNTFQHRLQNLSRILAFSPPLVLQSLKEKIDDHDPMISEQMVLDTFAATGCVEILKDSVRQLPPQVWMSQ… |
| A0A7J5YZS4 | 127-492 | None |
| R7T731 | 6-339 | None |
| A0A8B6DAW4 | 102-481 | None |
| H2YLI2 | 193-548 | None |
| A0A8B6ES81 | 1-359 | None |
| A0A4Z2CGM4 | 210-573 | None |
| A0A1U8E0D7 | 555-944 | None |
| A0A060XR48 | 301-663 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.