DPCstruct | MC19247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 180 ± 18 aa |
| Standard deviation of domain lengths | 17.52 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822GJ72 | 1-150 | MNELQKKIKDTTRKMMSCIAELSMQQAYYIKLQQETRDKEKFMQRCYTRMEQGLPPSEETEQEWKRLLREEQRRRLEKHEKARMEEE… |
| A0A7S1SHT4 | 2-193 | QLEERLNDKKEQLLEKELILEEITSLSDRLRGQAAEGRADTLDLAKKVNDYQSRIRAVTRKLMATISELSMYQATGIKLAAERDELG… |
| A0A2A9MD66 | 122-301 | None |
| A0A3P9MKB0 | 216-409 | None |
| A0A671L3Q1 | 157-360 | None |
| A0A3Q3AJU9 | 18-177 | None |
| A0A7J8D507 | 412-573 | None |
| A0A7S1GTR0 | 257-462 | None |
| I3KJE9 | 88-255 | None |
| A0A0D2M3A9 | 161-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.