DPCstruct | MC19245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 4.53 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 60.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819C950 | 40-112 | LVEPQALRFKLEEPIHLLGRDKFANVDVRIRVKGGGRIAQIYAIRQALAKSLVAYTQKFVDEATKKQFRDILV |
| A0A822GAD1 | 1-74 | MIEPRTLQYKLLEPVLLLGKERFAGVDIRVRVKGSGHMAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIH |
| A0A068YE33 | 408-480 | None |
| J3NAZ6 | 378-456 | None |
| A0A427YSY2 | 2-68 | None |
| M4CD75 | 277-355 | None |
| A0A0E0MBX9 | 2-68 | None |
| A0A0R3QIN5 | 1-81 | None |
| A0A261XVE0 | 506-584 | None |
| A0A2I3G9S1 | 31-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.