DPCstruct | MC1924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 104 ± 21 aa |
| Standard deviation of domain lengths | 20.64 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0GJM2 | 12-113 | SVVEPDIKDETSFQELDMILTQYLETLSERKKYHIGYPTNMHYEHHAILAPLLQFSLNNCGDPFTQSPVDFHSKDFEVAVLDWFAQL… |
| N1QWG9 | 1-66 | MAALLAGFAHHLEERTDHHLGYPFNLDFDFGALNQFQSFFINNVGDPFIESNYGVHSRQFEVAVLD |
| A0A6P5MWF1 | 17-137 | None |
| A0A450U482 | 3-103 | None |
| A0A1E7NG66 | 1-146 | None |
| A0A377YW35 | 1-109 | None |
| A0A811P4J2 | 2-88 | None |
| A0A2J8A1C2 | 103-191 | None |
| A0A2P2J426 | 65-186 | None |
| A0A0K9RN25 | 61-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.