DPCstruct | MC19239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 118 ± 3 aa |
| Standard deviation of domain lengths | 3.28 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 53.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1C0C3 | 38-154 | DSGEYPLIQSSPAWRRFRSNFVEFIQVLIRQCQYSIIYDQCMIDQVISLLTGLTDSQVRAFRHTSTLASMKMMTALVDVALNVSINR… |
| A0A1U8C9U6 | 188-304 | DSGDYPLTASGPSWKKFQGSFCEFVKTLVYQCQYSLLYDGFPMDDLISLLIGLSDSQVRAFRHTSTLAAMKLMTSLVRVALQLSLHR… |
| A0A673WCY8 | 235-350 | None |
| A0A0S7JXQ4 | 184-298 | None |
| A0A2G9SCG1 | 214-330 | None |
| A0A5N4CXP3 | 155-275 | None |
| A0A5J5D315 | 125-250 | None |
| A0A0S7JZ24 | 45-164 | None |
| H2PP83 | 1-117 | None |
| A0A4Z2C3J2 | 71-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.