DPCstruct | MC19238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 102 ± 21 aa |
| Standard deviation of domain lengths | 20.64 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 67.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08313 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5BTV1 | 1-66 | MPTHLPTKIRLYLGPLNLDKHCGVINKNGMPCARNITCKVHGMNAKRAVQGRTKSYDQLFIEHKRA |
| A0A822E7Y4 | 105-207 | SSLSKQSVVPKPVPPSPEKILNGKGISSVDKKHQNGTKNSNKPYKRICAEREFDPNKHCGVLDPETKKPCTRSLTCKTHTLNHRRAV… |
| A0A433Q4N9 | 11-110 | None |
| A0A146H1Z6 | 198-295 | None |
| A0A4S2N300 | 6-102 | None |
| A0A4S9MWF2 | 6-99 | None |
| H3B9G1 | 205-295 | None |
| A0A482WUF3 | 298-419 | None |
| A0A4Q4UV66 | 527-629 | None |
| A0A1C7NMA6 | 15-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.