DPCstruct | MC19237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 4.02 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 27.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A532U8T0 | 9-74 | RLRYEKTLQAIGRLAEKQRLREICILEVEGGVVLQGQALVTTRDGYHLVSKTKVLSHEDLAQLMRE |
| A0A532U8S9 | 7-82 | GMAKTDYQDVLRTIGHYADQHGFTGIRLMETEDGLILQGKVGTGEARGEKRTETYLLTVQDVRDLMREAYTRRGTR |
| A0A2H5Z559 | 45-116 | None |
| A0A0P9F6B6 | 3-78 | None |
| A0A8B5XJE6 | 11-85 | None |
| A0A7C5UPI2 | 7-72 | None |
| A0A399ZPF7 | 1-73 | None |
| A0A7V9F7X2 | 74-139 | None |
| A0A399ZR26 | 13-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.