DPCstruct | MC19234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 242 ± 49 aa |
| Standard deviation of domain lengths | 49.29 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0552 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0CTU9 | 32-173 | SNSCRFSDMSIFFAQLVLSSCEAQSSLKLVVRSLNKTPHLLIWLLDSYIVAAMGELRDEENESPQPEIRPFPAVKMLYKVFDAQSAA… |
| A0A1V2L5T4 | 76-279 | HCHKPHDTEHHSHHIDTERFSTLKPLNNAIITGSYYFAFRASDTAFKVRMEQDKMYCEGCGTLVGEYDGASGLDKLFKWCVELDGDN… |
| E4ZVZ3 | 334-613 | None |
| G4TYY3 | 95-288 | None |
| S3CHW0 | 819-1025 | None |
| A0A0G4NIH7 | 453-650 | None |
| A7AVF8 | 359-524 | None |
| A0A0A8ZML4 | 21-284 | None |
| A0A1E2YAM4 | 22-230 | None |
| A0A6J8DTW6 | 92-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.