DPCstruct | MC19232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 149 ± 29 aa |
| Standard deviation of domain lengths | 28.65 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.13 |
| Pfam Score | 97.78 |
| Assigned Pfam label(s) | PF10149- CL0293- PF05832 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183BWS6 | 126-245 | WVLLVCTAFLTLQWQWMLSLHSADLWAVKNVTGRLMVGLRWWSLVDADGKNHWKFEISQDSEKYDAFERQIFWAALVAAPFFWALLV… |
| A0A061AJA2 | 12-161 | LDTNQDNQAPSSHTYLDCFSPITFILLLAADFWNVKNISGRLLVGLRWWNETDDNGESIWVFETANPDRVINPIDSKVFWIMLYSTP… |
| A0A7J6U7T9 | 39-225 | None |
| A0A7J8J3E3 | 1-93 | None |
| A0A0D8XVW3 | 223-389 | None |
| A0A0V0R0T3 | 47-174 | None |
| A0A2K5MX81 | 73-178 | None |
| A0A0D2N4X7 | 7-104 | None |
| A0A7T8KJM0 | 16-129 | None |
| D3B7H3 | 223-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.