DPCstruct | MC19230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 200 ± 18 aa |
| Standard deviation of domain lengths | 17.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 14.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R0FGE0 | 3-211 | IDFTKNIIIIIGSCLAMLFTMLQIYKLYSDSKKNSKEALFNDYENTLHILENVSEDDEIYIRIKRLCDEKKYKYLIGESSVSLDCAR… |
| A0A1I4SI59 | 1-211 | MDFDQGLKIATWIVLTVLGLVGVWFSTRQFTLGAKAANREEYKFAKSFFEDIKQNADMHPFARQKGYQAIAGSQSLPAPVIEHLMSL… |
| A0A1F1FSN3 | 1-220 | None |
| A0A363S1B5 | 7-189 | None |
| A0A649YP22 | 3-217 | None |
| A0A855GX46 | 79-246 | None |
| A0A1B4FEV5 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.