DPCstruct | MC1923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 235 |
|---|---|
| Mean domain length (aa) | 117 ± 28 aa |
| Standard deviation of domain lengths | 28.20 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 77.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6A7H8 | 4-84 | VNGAQRAPTGRATCRACREAIEKGAWRVALVFYEDGRYQPSGFVHAGCVSAYLETTRIVMPARHFSPELGDEDMAEFEAAL |
| A0A5N6V1D6 | 3-108 | SYRLEQASTGRAGCQNKECKDEKVKIAKGELRLGTWVDTERIQAFFWRHWGCVTPRIIASLNENLGDDDEKDYEQLDGFEDLTPENQ… |
| A0A0D8XGG5 | 1-128 | None |
| A0A067C016 | 13-135 | None |
| F4Q1D0 | 2-126 | None |
| A0A7S3ZRT5 | 542-651 | None |
| A0A7S4E216 | 146-292 | None |
| A0A7S4A5G1 | 159-252 | None |
| A0A0G4HC14 | 3-109 | None |
| A0A7W0Q2Y9 | 961-1045 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.