DPCstruct | MC19229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 83 ± 13 aa |
| Standard deviation of domain lengths | 12.89 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G9AW73 | 134-215 | RVPCGWCHAPVVWALTRKNVESPIDAEPSADGHLVLSVDDRGPRCHPLDALQIPAARAHGQRLHTPHRKTCPQGGRPTWTRV |
| A0A849PG07 | 79-157 | SGFCTACGQALRWVVTSNGRRMPLDPLPTRRGNVELRPSGRQLLAFVHGNHEIPIKAESAYRAHQATCPNRVKPRPDGE |
| A0A386WV08 | 2-64 | None |
| A0A6G7Z265 | 91-164 | None |
| A0A1G9MJK0 | 5-90 | None |
| A0A260WFH5 | 1-90 | None |
| A0A6J4W933 | 4-90 | None |
| A0A3S0C147 | 4-74 | None |
| A0A3E0HEF5 | 90-171 | None |
| A0A1W1UYA4 | 4-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.