DPCstruct | MC19227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 109 ± 7 aa |
| Standard deviation of domain lengths | 6.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5R9NYS4 | 10-123 | MCNEARAAFKDVGLAYNDLTLPRVSLLRDIVDRHLRESMLMKGTYKADKKVVLKFMPNGVYGAVTCSAHYFDKREAVTFNPEGFIGF… |
| A0A2S1KQ40 | 19-132 | QAMRNYAREYYATNVGSEIPDVKQVHRLVEIINFVLVQYLELPHTFYEMINFDEQVKIYHSPKAVEITVNSDYFNGREAITFNSDGF… |
| A0A6B3WFI5 | 266-383 | None |
| A0A1E4G2I4 | 83-184 | None |
| A0A2D5VKD9 | 21-128 | None |
| A0A415JIW0 | 4-98 | None |
| A0A3S5BYS8 | 1-110 | None |
| A0A369P7B4 | 6-126 | None |
| A0A6I6RB84 | 137-242 | None |
| A0A7Y8ZMM1 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.