DPCstruct | MC19225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 339 ± 53 aa |
| Standard deviation of domain lengths | 53.28 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.65 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0219- PF08411 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0F0Q7 | 10-387 | TFLFHDYETFGTHPALDRPAQFAAIRTDSEFNVIGEPEVFYCKPADDYLPQPGAVLITGITPQEARAKGENEAAFAARIHSLFNVPK… |
| B8KX06 | 75-407 | PEGTQWPARDNGLPSFRLEDLTAANGIAHGAAHDALSDVDATIDLARHFQNVQPALFAELLSMRRKRHVETLMDLGSLRPVVHVSSM… |
| A0A845S0Q1 | 19-331 | None |
| A0A263HCL2 | 101-365 | None |
| A0A529TR44 | 3-267 | None |
| G2ZNG5 | 386-748 | None |
| A0A378N6D1 | 14-331 | None |
| A0A836QPU8 | 1-252 | None |
| A0A220VEN6 | 69-415 | None |
| A0A6L7RW13 | 63-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.