DPCstruct | MC19220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 84 ± 4 aa |
| Standard deviation of domain lengths | 4.33 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01888 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523C1N5 | 56-134 | GFTTGAGAAAAAKAAAMLWTGQPCPDEVSVANPQGERLVIPVAAGKARRGRAWAYVVKDAGDDPDVTHGVKIIAIIEEA |
| A0A4Q2WPF8 | 1-83 | MANLNSELRTGYTTGSCAAAAAKAAARYLVSGAECSEIAISLPRGGQVELKIDRFERGRGFCRAHVTKDAGDDRCYPWPIRHC |
| A0A096DBV6 | 8-93 | None |
| S7SX91 | 20-102 | None |
| A0A0P9ZQH8 | 154-241 | None |
| A0A0J1G9F6 | 14-100 | None |
| A0A367ZXB8 | 11-102 | None |
| Q3JSE4 | 531-618 | None |
| A0A1V6LYH6 | 3-76 | None |
| A0A1W6HSC8 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.