DPCstruct | MC1922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 262 ± 38 aa |
| Standard deviation of domain lengths | 38.42 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A7B2V2 | 289-585 | LGSPAPSRPVSSGSSAPDDRLKKRAPRPKTSFLFALPVQPNSRSKLYIRPKVLLQLHQVIAAQRPKPVYEVIPFSLLPQRSTRRLAR… |
| A0A5N6UYY4 | 403-661 | TTRTSTTQTTTSTVQTKHQTFPLAHPPPPKHTLRLTANLALQIQQLTPTSRRPIPILEVYQPTRFGKTVGDAPRKLTARDMYIVQSD… |
| A0A317X935 | 39-359 | None |
| A0A5M3Z586 | 2-227 | None |
| A0A0G4KE85 | 12-206 | None |
| A0A395IJ37 | 8-298 | None |
| A0A1B7P5X3 | 2-240 | None |
| A0A319ECD1 | 3-266 | None |
| A0A6G1NFB0 | 123-415 | None |
| A0A1V6RGS9 | 7-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.