DPCstruct | MC19219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 121 ± 12 aa |
| Standard deviation of domain lengths | 12.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 32.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M9YZ98 | 5-127 | LRTEYERRAALVELDALVSVQLGITAEQLAAIYRARFPILADYEAEMWFDAKGRKIAGNHNTYGYGQTKDDYLQLQAHLADRTGATP… |
| A0A4Q5AUB9 | 19-132 | AMALGLTLEELIDIYRFTFPVLKSYEDDTWYDQTGRVVFSAKKAYNKISLTRDEFDKIRDEQNGFVKTITVSDDTLPEGPITREISF… |
| A0A0G3HAT1 | 81-199 | None |
| A0A1F1UVG0 | 18-131 | None |
| A0A839D5G5 | 386-525 | None |
| Q5P8V0 | 2-142 | None |
| A0A7V5V4I0 | 1-105 | None |
| A0A7Y1UWE4 | 26-158 | None |
| K0Z5F5 | 107-233 | None |
| A0A845C7W7 | 52-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.