DPCstruct | MC19216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 98 ± 9 aa |
| Standard deviation of domain lengths | 9.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A068NZ66 | 12-106 | LTEAQTEALVEKMASEICRRKLQGPAILMLEMNKPLAPVLAQAAVIASPFAIPFVGFDNFNDYSRLMAKRENVERLLVKIEELSRGP… |
| A0A7C3Z0U7 | 3-92 | TEELIERVAKRIVELRLTPIAIVLLESAKPLSFVGSQVLVFFQPIVTSIFPLNSYEEFVRILEDRNNVERLIQMIENEENQREKIRL… |
| A0A3M2E0I9 | 55-147 | None |
| A0A7V6TFU6 | 3-106 | None |
| A0A0M2UZX4 | 85-185 | None |
| A0A538T1C9 | 7-99 | None |
| A0A7X3ZDH5 | 80-174 | None |
| A0A662NWK2 | 18-114 | None |
| A0A3N5S260 | 3-117 | None |
| A0A3M1TSZ9 | 4-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.