DPCstruct | MC19214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 368 ± 28 aa |
| Standard deviation of domain lengths | 28.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0M0A5 | 53-432 | ADLARDQLVHGLTVSAGTTPDPFTGKVLGVLNDGIAPGLDMILVRLTSPEIRRVGGIWAGMSGSPVYADDGSLIGAVSYGLAFGPSR… |
| A0A2N9LZF0 | 2-313 | QGMSGSPVYIQGKLAGAVAMAFPFSKDPIAGIRPIQDMVRSSATLASAPRQHPLIAWNDRDLRRALPKPEPALAGGERMIDIATPLS… |
| A0A136M721 | 29-385 | None |
| A0A7C6PLL9 | 52-487 | None |
| A0A257LV41 | 9-363 | None |
| A0A1F8EU92 | 30-367 | None |
| A0A3N5WKV0 | 27-383 | None |
| D7CRG5 | 38-403 | None |
| A0A7W1B7F6 | 1-359 | None |
| A0A2H6B7S8 | 314-718 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.