DPCstruct | MC19213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 191 ± 26 aa |
| Standard deviation of domain lengths | 25.57 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846C429 | 306-475 | QVYSANYQNILALLFLAFVLIWNLNSISPEIFPIPKIVRATNLILRLDQKWSMFAPYPSVEDGWYVIPGKLKNGKEIDLFKNGKPVI… |
| A0A068NP89 | 58-244 | PNAPWYIKAFVVFHLFCITVWATPAPQEAVRTGKAKPLGSDYLLVWNDRYLKTIQPLRTYLFVSGFWQYWDMFAPNPAQIDFWVDSE… |
| A0A2E3RGD8 | 2-208 | None |
| A0A1R3WK80 | 14-232 | None |
| A0A6M4PLV9 | 53-250 | None |
| A0A7C4UX33 | 20-208 | None |
| A0A4V0I897 | 125-372 | None |
| A0A3M1BYN5 | 128-301 | None |
| A0A841N803 | 1-192 | None |
| A0A1N6JHC5 | 15-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.