DPCstruct | MC19212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 124 ± 20 aa |
| Standard deviation of domain lengths | 19.74 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 13.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F2Q078 | 2-90 | EKVPVVSLSKTSIVLNNVARQKIDSGRIELAFDRDTHTIRIKAVDEGGIEMKKTKVFGKGFFNHFGITRRGKFEAKYEPEEKAIYAN… |
| A0A8A6WYE4 | 36-169 | QVAGGTMPFEVFDKRMTPLAKAPSVTIQNRGVISLNKAAHDLIDNAETVELLYDRDRHVIALRAADDSSPHAYAVRSGSKRGPGQAI… |
| A0A5M9U7Y8 | 14-141 | None |
| A0A8A3LUB9 | 1-141 | None |
| A0A7H4K6A1 | 1-141 | None |
| A0A1C2Y281 | 36-148 | None |
| A0A1I7JU44 | 457-621 | None |
| A0A2D6PI88 | 1-122 | None |
| A0A843FMC2 | 23-136 | None |
| A0A855Y9J3 | 25-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.