DPCstruct | MC19211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 209 ± 54 aa |
| Standard deviation of domain lengths | 54.05 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 84.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7QCX2 | 4-162 | YELLIKSLLQFPSEKWLSRYFDLVKKLLTDLDIDSNDPRLALTLPKNGILPVNLGQRYVFRPGNDGYVGCIVPIDFDTESVDGFEVF… |
| A0A7X7XL10 | 273-467 | EVGWWGDLKETLALMDRYAEHFGSSEEPAALAVHEGARADSEDAFLALAGAQGGPEVLAMARTYVERMGLGAGSFSLSALPNTGRSG… |
| H8GUM4 | 30-343 | None |
| A0A6L7UU20 | 180-341 | None |
| A0A495A9K5 | 48-294 | None |
| A0A494RPT3 | 355-609 | None |
| A0A351LDK7 | 6-194 | None |
| A0A1M7Q4S7 | 36-226 | None |
| A0A661Z1X6 | 7-146 | None |
| A0A2N7T9U5 | 4-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.