DPCstruct | MC1921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 542 ± 91 aa |
| Standard deviation of domain lengths | 91.49 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.66 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0023- CL0093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6URI5 | 26-494 | FLTSHPPDVPVRSRIVAVCGISDVDNNADPQKDGWFISDFFLFYHLLQRPFTRDVNQIWMLCESPKSLAEKYKEYAHGDPRKERRVV… |
| B6HQT3 | 7-478 | HSFTLVVFCGGILDASLATDFVMVSKKFMADGLDPTCLSGTHLRLITDTTGPFLFGRDDLGPRSQIYDSSEAANPFYHIAGPGGLKR… |
| A0A6P8AYJ3 | 15-564 | None |
| A0A5N6FCF7 | 8-335 | None |
| A0A3N4INT0 | 154-633 | None |
| Q2H4U4 | 24-677 | None |
| A0A1J7JGJ6 | 216-728 | None |
| A0A232LRF2 | 1-591 | None |
| A0A094HWJ0 | 28-623 | None |
| A0A6A5XH26 | 18-509 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.