DPCstruct | MC19209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 306 ± 29 aa |
| Standard deviation of domain lengths | 29.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z1WRK7 | 485-793 | MAYVVPTFRRARTVDHQHLTVTQRRTTAGLRVYLNRPWYSSGDDEMLAVVLDPGTDLKDHLATRWGVDPVWSGTPPLPKPAAAHFPN… |
| A0A7C6MFB9 | 3-329 | DVIPLLLWEQRTEPDQPFALRRTRRSGARIWLERPWFSSGDGELLGVVVDATGTLPPTLSSRWGKDPVLATAVPAATTLPPLVRPAD… |
| A0A2R4SW85 | 683-986 | None |
| A0A3D4ZWG5 | 1-266 | None |
| A0A1C4YGW3 | 831-1113 | None |
| A0A0M4DM12 | 599-889 | None |
| A0A2W1A2X2 | 229-531 | None |
| A0A7L4Q498 | 314-621 | None |
| A0A7X9FVY4 | 14-389 | None |
| A0A089LI41 | 987-1265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.