DPCstruct | MC19206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 225 ± 32 aa |
| Standard deviation of domain lengths | 32.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A774NA18 | 1-195 | MPEGYIAKPFYKWGDATGIAGNLPVFKTDGSNTTEEQAAQAGMHHDGMAWFSLPQGGNSSDHGLLAINHEYIDNGLLFKDGDANWSA… |
| A0A1H2ZFE1 | 46-244 | NTAIAGVFGAAGVASSANAADPTLLPPTAEGKRPLGLNPTLGFDAIPVTRSDTATVPFGYKAQALVPWGTPITGSAPAYDGVNGNSG… |
| A4CRX2 | 306-522 | None |
| A0A0K2R6S5 | 59-276 | None |
| A0A522DD55 | 1-217 | None |
| A0A6G3VBX0 | 1-175 | None |
| A0A4R7AA80 | 63-293 | None |
| T2JMW2 | 1-232 | None |
| A0A6I1IZY7 | 20-229 | None |
| A0A2E3NK80 | 116-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.