DPCstruct | MC19201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 5.49 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 55.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A365VR37 | 1-74 | LFGAGREKRLYAIPPYTKVESLAFDDHPFTAQSWEQGCALCGSRTSYLDEIVTDDAGSRMFVCSDTDYCQREKQ |
| A0A7H4PD99 | 3-83 | MMPALQLFGAGREKRIYAVPPYTPVESLDFDDHPFTVQEWDEPCAICGSRHSYLDEVVLDDSGKRMFVCSDTDYCRQQSEE |
| A0A7C2NBC8 | 145-237 | None |
| A0A853ME21 | 16-100 | None |
| A0A2X4TSG2 | 138-220 | None |
| A0A3M5F1Q7 | 314-396 | None |
| A0A381KM52 | 95-179 | None |
| A0A377E091 | 356-434 | None |
| A0A6J5FXA1 | 21-101 | None |
| A0A7C1AGH7 | 129-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.