DPCstruct | MC19200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 175 ± 10 aa |
| Standard deviation of domain lengths | 9.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.39 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0123- CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4NR31 | 1-186 | MSSGRLQQQFIRLWQCCDGKSQETTLNALAEMLSCSRRHMRTLLNMMEARGWLTWEAEAGRGKRSRLSFLYTGLALQQQRAEDLLDQ… |
| C2VVR2 | 12-202 | KGDRKMDKTLLNLWQSFSSGNIKIQDLADFLNLSTKQTVRYLHKWMDEGWLTFISGKGRGNPSSLQWLKNVEQIYESQVMEIMDQQP… |
| A0A1E8BCE5 | 2-171 | None |
| A0A379WEH9 | 1-163 | None |
| A0A2T4ZCJ1 | 1-169 | None |
| A0A4P6ERG2 | 3-185 | None |
| A0A4U9D648 | 1-170 | None |
| A0A381H8E3 | 1-167 | None |
| A0A090QL80 | 1-187 | None |
| A0A379SJ57 | 1-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.