DPCstruct | MC1920
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 112 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 59.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6UNG5 | 1-111 | MPRPGQVLGLVGTNGIGKSTALKILSGKLKPNLGRYDNPPDWEEILKYFRGSELQNYFTKVLEDDLKAVVKPQYVDQIPRAVKGPVQ… |
| A0A1Y3EI58 | 51-180 | THRYGPNSFKLHRLPTPRPGEILGLVGTNGIGKSTALKILSGKLKPNLGKYKEPPEWQEILTYFRGSELQNYFTKLLEDNLRAVIKP… |
| A0A4D9BK25 | 96-202 | None |
| A0A812JG73 | 342-429 | None |
| U6KZ54 | 111-227 | None |
| A0A556U042 | 312-418 | None |
| A0A4T0R1N0 | 626-734 | None |
| A0A6A6RNY4 | 1-111 | None |
| A0A553NBF6 | 186-303 | None |
| B1N3F3 | 101-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.