DPCstruct | MC192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 10.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 54.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4DUS7 | 1-96 | MEDRATLRISSQHIANWLLHGIVSAEQVRTTLERMAAVVDKQNEGDPAYTPMVGRFDTSPAFLAACDLIFKGTEQPNGYTEPLLHHW… |
| A0A432JF85 | 14-133 | PWVHRGIGCSGVPNFSQIEEMKDRATERIDGAIIANWRLHGVVSQTEIEDAVKKATEILDQQNQGQPGYEPMTDTPEKVAGLLQEPV… |
| A0A5N9VWQ2 | 115-230 | None |
| A0A814BNM6 | 614-728 | None |
| A0A7S2KH40 | 88-212 | None |
| A0A376WSW8 | 2-98 | None |
| A0A6I1QX23 | 95-201 | None |
| A0A0N0X981 | 3-116 | None |
| A0A7J6Q8E2 | 1058-1181 | None |
| A0A815KYY8 | 60-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.