DPCstruct | MC19198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 161 ± 15 aa |
| Standard deviation of domain lengths | 15.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6JRK5 | 80-237 | RAQPLTWKAMRGSLKMFKRNYFRYGLALDANFQQAFLEGELNGNAMLYGGSQVSHALLNEKNFRLYAGRRFAGAVPDFADDAPVYVL… |
| A0A7H4NM62 | 24-164 | FRFGLAFDPQFNCAMLEQEIAGNALLYDGDNGVVAPNSVNLENYARRRFKQTLSWPQDPQQPLWRFKTQGIFCDRFGTKVMEQSGRG… |
| A6GMC9 | 53-212 | None |
| A0A4R6FYC9 | 86-245 | None |
| A0A1E3X761 | 412-609 | None |
| R2SB10 | 78-245 | None |
| A0A0C1Q235 | 3-182 | None |
| A0A562R040 | 125-289 | None |
| B9DJ61 | 43-202 | None |
| A0A6N7D169 | 96-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.