DPCstruct | MC19197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 318 ± 50 aa |
| Standard deviation of domain lengths | 49.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655JL47 | 2-304 | FDASHAEVARWFTEGLVDGVRVDHLDGLSDPSGYLAQLRELLGPNAWIVVEKILAVDEALEPTLPVDGSTGYDVLREIGGVLVDPQG… |
| A0A7H4NJC8 | 36-312 | HRLILELVHSGIVDGLRIDHIDGLADPLGYLQRLRQATGPECYITVEKILAKGEQLPADWPVSGTTGYEFIASLAEVLVDDNNLDQL… |
| A0A4Q2Y5G7 | 1-255 | None |
| A0A535XMV1 | 1-189 | None |
| A0A2V6QTL2 | 140-426 | None |
| A0A1E3VRN0 | 2-283 | None |
| A0A7V9DM54 | 125-485 | None |
| A0A532E898 | 193-551 | None |
| A0A7C1H7F3 | 186-572 | None |
| A0A2V7XZT3 | 220-607 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.