DPCstruct | MC19194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 4.71 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 74.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379ADL9 | 111-177 | MYRYLAIANYEDRFVVPSSHRELAREAFPESKGCGFSFGDGCHGSDSKFNLFNSRRIDAIDISKKTI |
| A0A7H4NHB7 | 1-61 | MYRYLAIANYEDRFVVPSSHREQARDAFPEKNGCGFTFGDGCHGSDSQFNLFNSRRIDAID |
| A0A376W2I8 | 1-61 | None |
| A0A1A8Y1N4 | 51-112 | None |
| A0A3S4IK93 | 32-92 | None |
| A0A0C2MKV8 | 425-491 | None |
| A0A447JIH7 | 153-224 | None |
| A0A7V0RJ24 | 132-187 | None |
| A0A378BDW3 | 765-825 | None |
| A0A447U319 | 74-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.