DPCstruct | MC19190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 77 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 56.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00285 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0FCD8 | 3-87 | VMCGITGALAAFYHDSLDVNNPRHREIAAFRLLSKMPTMAAMCYKYSIGQPFVYPRNDLSYAGNFLNMMFSTPCEPYEVNPILER |
| A0A7H4N4E4 | 3-81 | VMCGITGALAAFYHDSLDVNNPRHRDIAAFRLLSKMPTMAAMCYKYSIGQPFVYPRNDLSYAGNFLNMMFSPRRVKNMK |
| A0A2Z4YUI7 | 7-76 | None |
| A0A6A5L8G0 | 136-213 | None |
| A0A654TR02 | 208-290 | None |
| A0A1V4FW56 | 3-78 | None |
| A0A7J6U1L1 | 163-237 | None |
| A0A521SIY0 | 136-216 | None |
| A0A7W9CY92 | 43-120 | None |
| A0A6L5DDP3 | 863-936 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.