DPCstruct | MC1919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 185 ± 16 aa |
| Standard deviation of domain lengths | 16.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9S8S3 | 15-200 | PNHCWICGHSLEARHYVRIGKPPPLVREKQEWEQMWKERRQSRKTEKRVFAIDMSASELSRAFRVPGRWNTLFRMILERPGQPYKLS… |
| A0A5N6UI33 | 14-194 | VLGCCAICGEFVGPQSASIGPGIRAADIFKSSTEWKQCVQKQGYVSGHISELEKVYLRHPWLWAWLYRAILYEPSTDKFRLTGVGFA… |
| A0A397HSJ6 | 1-191 | None |
| A1D2I0 | 3-201 | None |
| A0A0S7DRQ8 | 417-589 | None |
| A0A0F4YWM4 | 9-159 | None |
| A0A0U5G8D1 | 1-180 | None |
| A0A0F4YLJ0 | 9-208 | None |
| W6Q8T8 | 2-207 | None |
| A0A5N6SRT2 | 13-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.