DPCstruct | MC19189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 79 ± 15 aa |
| Standard deviation of domain lengths | 14.97 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 92.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844VXW8 | 36-118 | MGHYMREWLAQQKLVTSGECPPENAVYAYANSLQRTVATAQFFITGAFPGCGIAVHHQPQMGTMDPTFNPVITDDSPAFREKA |
| A0A379TFM9 | 1-68 | MGHYTREWLVAQGLIPSGECPAPDSVYAYANSLQRTVATAQFFITGAFPGCDIPVHHQEKMGRHGPYL |
| A0A0N8SSH1 | 83-195 | None |
| A0A376J722 | 31-99 | None |
| A0A6F8QPL3 | 67-134 | None |
| A0A379S6A3 | 82-163 | None |
| D3P3N1 | 1-63 | None |
| A0A6C7H689 | 46-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.