DPCstruct | MC19187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 98 ± 8 aa |
| Standard deviation of domain lengths | 7.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10150 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2L026 | 1-78 | SGDDAWKTISDYVIAVAPELLPRMTKYEPASPDGPDVFAVHRIDEQLAKAMDRKVWLPSGGTLVIDRTEAMTVIDVNT |
| A0A7H4N1I3 | 1-106 | MRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSSKIKLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTA… |
| A0A7W1YDV3 | 309-410 | None |
| A0A022S118 | 377-464 | None |
| A0A7X6ZT36 | 13-99 | None |
| A0A377XV14 | 2-76 | None |
| A0A2A4YUH2 | 152-247 | None |
| A0A509D067 | 62-159 | None |
| A0A2S8RE83 | 217-318 | None |
| A0A317FJW6 | 393-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.