DPCstruct | MC19186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 151 ± 16 aa |
| Standard deviation of domain lengths | 16.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05936 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q5GYC7 | 647-805 | MARIVECRADRRVILDDAFIPTAIRIEGAARLSMLLAELLGLLHQRGQALADRVAGSDRRGVAEIADVLMLQVINRYQPLVAHWASA… |
| A0A2U2H9V4 | 145-290 | LRVRRLANGGFELDPAFVPPSLTVHGAPALLLHLRCLIDTLQANVDALHAHQHTPGRHAGQIRCGGMSTFRLLHTASSALASLSYYF… |
| A0A3M2WBC3 | 280-430 | None |
| A0A356RDF8 | 230-369 | None |
| A0A447WC42 | 686-857 | None |
| A0A6N6X5D9 | 1-139 | None |
| W1DPM5 | 1-124 | None |
| A0A443XEC3 | 168-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.