DPCstruct | MC19184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Standard deviation of domain lengths | 10.80 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4MZM3 | 1-99 | MLNLASVRQGVWRNRSHDPAGSDTRGAAAYDESYADTRLWVQQGWLDYIAPQIYWPFARDAARYDVLAKWWADVVKPTHTRLYIGVA… |
| A0A644XGD4 | 7-101 | IQFGISPFGIWGHAENYSEGSNTPVGSTSSLRDQFANTRKWVKEGLVDYLTPQIYWAFNTAAAPYGELLKWWDDQFKGVSNSHLYIG… |
| A0A7V5KJB8 | 6-77 | None |
| A0A1M3MVH6 | 4-76 | None |
| A0A660Y1U9 | 1-83 | None |
| A0A5S9M8S5 | 4-106 | None |
| A0A2V2GCF5 | 378-471 | None |
| A0A2X1KHE6 | 103-188 | None |
| A0A3M3DGQ8 | 1-91 | None |
| A0A2V7QQW1 | 2-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.